#realfoodfordogs risultati di ricerca
How sweet is Mabel, a new customer we met yesterday at the @WestportFarmMkt? (Well, we met her human, that is. Pups aren't allowed, per the health department.)🍃 #onmyfork #farmtofloor #realfoodfordogs @ Westport,… instagram.com/p/B2pF3QXlOVJ/…
My new friend Argos says he wants real food!! #nokibble #realfoodfordogs #petfood #peoplefood #quantumleap instagram.com/p/BqNkODjh_9C/…
Trying out a new tag line. What do you think? 😉❤🐶🐱😂 . #healthydogfood #realfoodfordogs #realfoodforcats #wholefoodforthewholefamily #doghumor #pethumor @ New Milford, Connecticut instagram.com/p/Bp4gTlpF3xh/…
Liver bites, bagels, and pansies. What's not to love about winter at the @WestportFarmMkt, especially when your neighbors are @muddyleek? 🌼 . #farmtofloor #farmtobowl #realfoodfordogs #dogloversfeed… instagram.com/p/B9cMI7xFrqs/…
Food prep day!!! gatorbug313 is ready for the week. Feeding Fresh food has never been easier! @messymutts #answerspetfood alwaysrealfood #realfoodfordogs #rawnation #rawfeddogs #rawdogfood #shopwooflife… instagram.com/p/B1kEGY0hwvd/…
My lad is a typical bull breed in that he's passionate about food. But there's one treat he drools over more and that's my calming liver cake! He helps by cleaning the dishes 😋😉 What's your dog's fave snack? #dogfood #realfoodfordogs #doghealth #dogtraining
Best buds Wilson and Jack are hoping you're heading to the @WestportFarmMkt tomorrow for some of Uncle Paul's delicious food and treats.🙏🏽 #onmyfork #realfoodfordogs #realfoodforpets… instagram.com/p/BzwgXVQlQ2F/…
Via our friends k9nitro519 Everyone on board! #nomorekibble #feedrealfood #realfoodfordogs… instagram.com/p/BhkAPfyjzfz/
Are you ready to engage? #challenge #15daystofresh #realfoodfordogs #wholefoodforthewholefamily #januaryreset #comingsoon @ Paul's Custom Pet Food instagram.com/p/BsHP-Zvl787/…
Meet us at the Wooffest on April 14 & 15!!! (we mean your dog 😉). You'll have the chance to try PawPots for FREE!! #realfoodfordogs #healthydog #foodfordogs #dogfood #happydog #lebanondogs #pets #dogtraining #pawpots #dog #dogs #instadog #dogstagram #dogsofinstagram #doglov…
#RealFoodForDogs? But for 50 years, my table scraps were a no-no. Funny how the narrative can change. #dogs #dogfood @Freshpet
Thanksgiving Turkey Loaf is ready for the oven! #realfoodfordogs #dogfood #dogfoodie #naturallyhealthypets #ifyoulovethemlikefamilyfeedthemlikefamily #naturallyhealthypets… instagram.com/p/Bqfqbf_AwsR/…
The latest Elizabeth's Star Roundup! paper.li/ChroniclesCard… Thanks to @RobinGanzert @MichelleSLT @RandomFelines #travel #realfoodfordogs
Nothing beats a weekend spent with your pup 🐶 What's your favorite weekend activity to do with your dog? #portlandpetfood #portlandpetfoodcompany #realfoodfordogs #myportlandpup
Do you love your dog? Then quit serving them crunchy cardboard—give ‘em real food! 🐾 Check out our fresh, nutritious meals at grubdawgs.com 👈 #RealFoodForDogs #dogsarefamily #DogLife #dogsontwitter #doglovers
Don't go bacon my heart 🥓 Our Bacon Brew Biscuits and Grain & Gluten Free Bacon Biscuits are the perfect treats to fulfill your dog's bacon dreams! #portlandpetfood #portlandpetfoodcompany #realfoodfordogs #myportlandpup
🐶 Your dog deserves real food, not fillers. At Fido Fresh, we make healthy meals with fresh meat, veggies, and everything they need to thrive. 🥩🥕🍚 Because happy, healthy pups start with fresh, real ingredients. #FidoFresh #HealthyDogs #RealFoodForDogs
Do you love your dog? Then quit serving them crunchy cardboard—give ‘em real food! 🐾 Check out our fresh, nutritious meals at grubdawgs.com 👈 #RealFoodForDogs #dogsarefamily #DogLife #dogsontwitter #doglovers
🐾 Give your dog the gift of holistic health with Glencadia Gourmet's chef-made food, crafted with farm-fresh ingredients sourced from the Hudson Valley. 🌿🍖 #RealFoodForDogs #HolisticPetCare #GlencadiaGourmet
Unlock the secret to rich, flavorful bone broth! Chef's tip: True stock perfection means bones clean of all meat after simmering for 48 hours. If they don’t look like this, your broth's journey isn't complete. #48HourBoneBroth #ChefSecrets #RealFoodForDogs #GlencadiaGourmet
#RealFoodForDogs? But for 50 years, my table scraps were a no-no. Funny how the narrative can change. #dogs #dogfood @Freshpet
Meet Lincoln (Linky for short), a four-year old fashionista, & his mom, Katie (who doubles as his fashion designer), sharing how their journey to real foods contributed to Lincoln’s “signature look.” 😎 buff.ly/3bhp8xI #realfoodfordogs #dogfood #rawfeddog
We love small dogs and small businesses. 12 year old Nico sampled Raw Vibrance while browsing @familydognaturals and enjoyed it so much, he took home a bag. How did YOU hear about Dr. Harvey’s? #drharveys #realfoodfordogs #healthyfoodfordogs #shopsmallbusinesses
#istandwithrealdogbox #turkeywing #realfoodfordogs #supportsmallbusiness #rawfeddogs @ Marysville, Washington instagram.com/p/CI4rBV-FEYS/…
Pup Plates has a kitchen!! #feedallthedogs #freshdogfood #realfoodfordogs #dogsofinstagram #dogsofthepnw instagram.com/p/CGazz_wAyf1/…
instagram.com
Pup Plates (@pupplates) • Instagram photo
Pup Plates (@pupplates) • Instagram photo
So true... @rickygervais @DogsTrust @DogsMonthly @TheGoodDogGuide @TheKennelClubUK @itsdougthepug @DogsForGoodUK #realfoodfordogs #puppy #dog #freshdogtreats
Simple steps to a fresh, healthy, balanced meal for your dog! Our diets offer convenience AND real-food ingredients, no synthetics or preservatives. You can relax, knowing you’re giving your dog the nutrients their body needs. 🧡💙💚 #freshdogfood #naturaldogfood #realfoodfordogs
Fresh chicken with parsnip & courgette for Pip today - plenty of potassium, manganese & B vits in this recipe. To make a 750 kcal batch, you'll need 500g chicken, 300g parsnip, 75g courgette + 3g calcium carbonate #dogfoodrecipes #dogfoodie #realfoodfordogs #homecookingfordogs
Few things.... 1. How crazy cute is her face? 😍 2. She turns 13 next month! ❤️ 3. She has quinoa on her little nose, and we can’t handle it 😩💛 • • • #realfoodfordogs #kickthekibble #freshdogfood #aafco… instagram.com/p/CBi0fVAAk7P/…
Lunch for Pip today is beef with pasta & broccoli. For 1 day for a 5kg pup: 125g lean beef mince, 75g pasta, 25g broccoli, 2g calcium, 2g yeast extract. Cover with water boil gently until the pasta is cooked. #realfoodfordogs
In Pip's VetChef dinner tonight - pork, carrot, courgette & potato, plus a little calcium. Packed full of protein, vitamins & minerals - and so much tastier than brown lumps out of a packet #homecookingfordogs #realfoodfordogs #puppydinner #puppyfood #dogfoodrecipes #dogfoodie
My lad is a typical bull breed in that he's passionate about food. But there's one treat he drools over more and that's my calming liver cake! He helps by cleaning the dishes 😋😉 What's your dog's fave snack? #dogfood #realfoodfordogs #doghealth #dogtraining
Liver bites, bagels, and pansies. What's not to love about winter at the @WestportFarmMkt, especially when your neighbors are @muddyleek? 🌼 . #farmtofloor #farmtobowl #realfoodfordogs #dogloversfeed… instagram.com/p/B9cMI7xFrqs/…
My lad is a typical bull breed in that he's passionate about food. But there's one treat he drools over more and that's my calming liver cake! He helps by cleaning the dishes 😋😉 What's your dog's fave snack? #dogfood #realfoodfordogs #doghealth #dogtraining
Unlock the secret to rich, flavorful bone broth! Chef's tip: True stock perfection means bones clean of all meat after simmering for 48 hours. If they don’t look like this, your broth's journey isn't complete. #48HourBoneBroth #ChefSecrets #RealFoodForDogs #GlencadiaGourmet
#WellnessWednesday~ People Food vs #PetFood What You Need to Know. Do you know that "pet feed" can include meat from animals referred to as 4D – dead, dying, diseased and disabled? #realfoodfordogs #rawdog #petnutrition #homemadedogfood #cookingfordogs raisingyourpetsnaturally.com/national-cook-…
#RealFoodForDogs? But for 50 years, my table scraps were a no-no. Funny how the narrative can change. #dogs #dogfood @Freshpet
Did you know Origins 5in1 contains 17 grams of protein, 3 grams of full spectrum fish oil, 755 omega 3 (EPA, DHA, DPA), and 42 naturally occurring essential fatty acids? ow.ly/zQCK50Erx4z #NaturalDogSupplement #DogHealth #RealFoodForDogs #WeLoveDogs
Colorado Springs we just got held up by a train. ETA 11.10 #rawdogfoodandco #realfoodfordogs #friendsdontletfriendsfeedkibble
Lily's Kitchen breakfast crunch - granola for dogs. Available now: vitalifehealth.com/lilys-kitchen-… #lilyskitchen #petfood #realfoodfordogs #dogfood #vitalifehealth
When you are unimpressed by home delivery because it’s your food they’re delivering ... #whereareyougoingwiththat #realfoodfordogs
Nothing beats a weekend spent with your pup 🐶 What's your favorite weekend activity to do with your dog? #portlandpetfood #portlandpetfoodcompany #realfoodfordogs #myportlandpup
Fresh, home-cooked, high welfare, sustainably packaged food for dogs! We’re very excited about this... Find out more at phoenixbark.com #realfoodfordogs #freshisbest
Do you love your dog? Then quit serving them crunchy cardboard—give ‘em real food! 🐾 Check out our fresh, nutritious meals at grubdawgs.com 👈 #RealFoodForDogs #dogsarefamily #DogLife #dogsontwitter #doglovers
We love small dogs and small businesses. 12 year old Nico sampled Raw Vibrance while browsing @familydognaturals and enjoyed it so much, he took home a bag. How did YOU hear about Dr. Harvey’s? #drharveys #realfoodfordogs #healthyfoodfordogs #shopsmallbusinesses
Don't go bacon my heart 🥓 Our Bacon Brew Biscuits and Grain & Gluten Free Bacon Biscuits are the perfect treats to fulfill your dog's bacon dreams! #portlandpetfood #portlandpetfoodcompany #realfoodfordogs #myportlandpup
Meet us at the Wooffest on April 14 & 15!!! (we mean your dog 😉). You'll have the chance to try PawPots for FREE!! #realfoodfordogs #healthydog #foodfordogs #dogfood #happydog #lebanondogs #pets #dogtraining #pawpots #dog #dogs #instadog #dogstagram #dogsofinstagram #doglov…
Something went wrong.
Something went wrong.
United States Trends
- 1. #AEWDynamite N/A
- 2. #Survivor50 N/A
- 3. Pope N/A
- 4. Selective Service N/A
- 5. Vatican N/A
- 6. Jericho N/A
- 7. Connor McDavid N/A
- 8. Ryan McMahon N/A
- 9. Lebanon N/A
- 10. #AbbottElementary N/A
- 11. Carter Bryant N/A
- 12. Hezbollah N/A
- 13. Greenland N/A
- 14. United Empire N/A
- 15. Zeal N/A
- 16. #ChicagoPD N/A
- 17. Raising Arizona N/A
- 18. Kenny Omega N/A
- 19. Pressure N/A
- 20. #ChicagoFire N/A